Class a: All alpha proteins [46456] (179 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins) |
Protein Mitochondrial cytochrome c [46642] (5 species) |
Species Horse (Equus caballus) [TaxId:9796] [46644] (15 PDB entries) |
Domain d1m60a_: 1m60 A: [74519] zinc-substituted complexed with hes |
PDB Entry: 1m60 (more details)
SCOP Domain Sequences for d1m60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m60a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Horse (Equus caballus)} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d1m60a_: