![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) |
![]() | Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry) |
![]() | Domain d1m5hh2: 1m5h H:7146-7297 [74508] complexed with k |
PDB Entry: 1m5h (more details), 2 Å
SCOP Domain Sequences for d1m5hh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5hh2 d.58.33.1 (H:7146-7297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Archaeoglobus fulgidus} egdfiiendigytngiaggnffimaetqpsalaaakaavdaisdvegvitpfpggivasg skvgankykflkastnekfapsirdqvegtqipagvkavyeivinglnadaikeatrvgi laatkipgvvkitagnyggklgkhiinlnelf
Timeline for d1m5hh2: