Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) duplication: contains two subdomains of this fold |
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) |
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry) |
Domain d1m5hh1: 1m5h H:7001-7145 [74507] complexed with k |
PDB Entry: 1m5h (more details), 2 Å
SCOPe Domain Sequences for d1m5hh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5hh1 d.58.33.1 (H:7001-7145) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeoglobus fulgidus [TaxId: 2234]} mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk lkffadgyqkevevggrkcwavpmm
Timeline for d1m5hh1: