SCOPe 2.07: Domain d1m5hg1: 1m5h G:6001-6145

Lineage for d1m5hg1 (1m5h G:6001-6145)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families)
   duplication: contains two subdomains of this fold

5. Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)

6. Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry)

8. Domain d1m5hg1: 1m5h G:6001-6145 [74505]
   complexed with k

Details for d1m5hg1

PDB Entry: 1m5h, 2 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

PDB Compounds: (G:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d1m5hg1:

Sequence; same for both SEQRES and ATOM records:

>d1m5hg1 d.58.33.1 (G:6001-6145) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeoglobus fulgidus [TaxId: 2234]}
mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
lkffadgyqkevevggrkcwavpmm

Timeline for d1m5hg1:

• d1m5hg1 first appeared in SCOP 1.61
  
• d1m5hg1 appears in SCOPe 2.06
  
• d1m5hg1 appears in the current release, SCOPe 2.08