Lineage for d1m5hg1 (1m5h G:6001-6145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955351Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955352Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 2955353Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 2955354Species Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry)
  8. 2955367Domain d1m5hg1: 1m5h G:6001-6145 [74505]
    complexed with k

Details for d1m5hg1

PDB Entry: 1m5h (more details), 2 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus
PDB Compounds: (G:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d1m5hg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5hg1 d.58.33.1 (G:6001-6145) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeoglobus fulgidus [TaxId: 2234]}
mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
lkffadgyqkevevggrkcwavpmm

SCOPe Domain Coordinates for d1m5hg1:

Click to download the PDB-style file with coordinates for d1m5hg1.
(The format of our PDB-style files is described here.)

Timeline for d1m5hg1: