Lineage for d1m5hf2 (1m5h F:5146-5297)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 258158Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 258159Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 258160Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 258161Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry)
  8. 258173Domain d1m5hf2: 1m5h F:5146-5297 [74504]

Details for d1m5hf2

PDB Entry: 1m5h (more details), 2 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

SCOP Domain Sequences for d1m5hf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5hf2 d.58.33.1 (F:5146-5297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Archaeoglobus fulgidus}
egdfiiendigytngiaggnffimaetqpsalaaakaavdaisdvegvitpfpggivasg
skvgankykflkastnekfapsirdqvegtqipagvkavyeivinglnadaikeatrvgi
laatkipgvvkitagnyggklgkhiinlnelf

SCOP Domain Coordinates for d1m5hf2:

Click to download the PDB-style file with coordinates for d1m5hf2.
(The format of our PDB-style files is described here.)

Timeline for d1m5hf2: