Lineage for d1m5hd2 (1m5h D:3146-3297)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192960Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
  5. 192961Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 192962Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 192963Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry)
  8. 192971Domain d1m5hd2: 1m5h D:3146-3297 [74500]

Details for d1m5hd2

PDB Entry: 1m5h (more details), 2 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

SCOP Domain Sequences for d1m5hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5hd2 d.58.33.1 (D:3146-3297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Archaeoglobus fulgidus}
egdfiiendigytngiaggnffimaetqpsalaaakaavdaisdvegvitpfpggivasg
skvgankykflkastnekfapsirdqvegtqipagvkavyeivinglnadaikeatrvgi
laatkipgvvkitagnyggklgkhiinlnelf

SCOP Domain Coordinates for d1m5hd2:

Click to download the PDB-style file with coordinates for d1m5hd2.
(The format of our PDB-style files is described here.)

Timeline for d1m5hd2: