SCOP 1.65: Domain d1m5hc2: 1m5h C:2146-2297

Lineage for d1m5hc2 (1m5h C:2146-2297)

Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family)
duplication: contains two subdomains of this fold
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry)
Domain d1m5hc2: 1m5h C:2146-2297 [74498]

Details for d1m5hc2

PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

SCOP Domain Sequences for d1m5hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5hc2 d.58.33.1 (C:2146-2297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Archaeoglobus fulgidus}
egdfiiendigytngiaggnffimaetqpsalaaakaavdaisdvegvitpfpggivasg
skvgankykflkastnekfapsirdqvegtqipagvkavyeivinglnadaikeatrvgi
laatkipgvvkitagnyggklgkhiinlnelf

SCOP Domain Coordinates for d1m5hc2:

Click to download the PDB-style file with coordinates for d1m5hc2.
(The format of our PDB-style files is described here.)

Timeline for d1m5hc2: