Lineage for d1m5hc2 (1m5h C:2146-2297)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) 
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) 
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry) 
Domain d1m5hc2: 1m5h C:2146-2297 [74498]
Details for d1m5hc2
PDB Entry: 1m5h (more details), 2 Å
PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus
SCOP Domain Sequences for d1m5hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5hc2 d.58.33.1 (C:2146-2297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Archaeoglobus fulgidus}
egdfiiendigytngiaggnffimaetqpsalaaakaavdaisdvegvitpfpggivasg
skvgankykflkastnekfapsirdqvegtqipagvkavyeivinglnadaikeatrvgi
laatkipgvvkitagnyggklgkhiinlnelf
SCOP Domain Coordinates for d1m5hc2:
Click to download the PDB-style file with coordinates for d1m5hc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m5hc2:
- d1m5hc2 is new in SCOP 1.61
- d1m5hc2 appears in SCOP 1.63
- d1m5hc2 appears in the current release, SCOPe 2.08
View in 3D
