Lineage for d1m5ha1 (1m5h A:1-145)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329902Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 329903Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 329904Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 329905Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75457] (1 PDB entry)
  8. 329906Domain d1m5ha1: 1m5h A:1-145 [74493]

Details for d1m5ha1

PDB Entry: 1m5h (more details), 2 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus

SCOP Domain Sequences for d1m5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5ha1 d.58.33.1 (A:1-145) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Archaeoglobus fulgidus}
mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
lkffadgyqkevevggrkcwavpmm

SCOP Domain Coordinates for d1m5ha1:

Click to download the PDB-style file with coordinates for d1m5ha1.
(The format of our PDB-style files is described here.)

Timeline for d1m5ha1: