SCOP 1.65: Domain d1m57h2: 1m57 H:30-129

Lineage for d1m57h2 (1m57 H:30-129)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (2 PDB entries)

8. Domain d1m57h2: 1m57 H:30-129 [74488]
   Other proteins in same PDB: d1m57a_, d1m57b1, d1m57c_, d1m57d_, d1m57g_, d1m57h1, d1m57i_, d1m57j_
   complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57h2

PDB Entry: 1m57, 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))

SCOP Domain Sequences for d1m57h2:

Sequence; same for both SEQRES and ATOM records:

>d1m57h2 f.17.2.1 (H:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d1m57h2:

• d1m57h2 first appeared in SCOP 1.61
  
• d1m57h2 appears in SCOP 1.63
  
• d1m57h2 appears in SCOP 1.67
  
• d1m57h2 appears in the current release, SCOPe 2.08