Lineage for d1m57h2 (1m57 H:30-129)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340565Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 340585Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 340586Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 340587Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 340591Species Rhodobacter sphaeroides [TaxId:1063] [81457] (2 PDB entries)
  8. 340595Domain d1m57h2: 1m57 H:30-129 [74488]
    Other proteins in same PDB: d1m57a_, d1m57b1, d1m57c_, d1m57d_, d1m57g_, d1m57h1, d1m57i_, d1m57j_
    complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57h2

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))

SCOP Domain Sequences for d1m57h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57h2 f.17.2.1 (H:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOP Domain Coordinates for d1m57h2:

Click to download the PDB-style file with coordinates for d1m57h2.
(The format of our PDB-style files is described here.)

Timeline for d1m57h2: