Lineage for d1m57b1 (1m57 B:130-289)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303168Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1303169Protein Cytochrome c oxidase [49544] (4 species)
  7. 1303224Species Rhodobacter sphaeroides [TaxId:1063] [74870] (5 PDB entries)
  8. 1303232Domain d1m57b1: 1m57 B:130-289 [74482]
    Other proteins in same PDB: d1m57a_, d1m57b2, d1m57c_, d1m57d_, d1m57g_, d1m57h2, d1m57i_, d1m57j_
    complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57b1

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1m57b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57b1 b.6.1.2 (B:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqarggtyel

SCOPe Domain Coordinates for d1m57b1:

Click to download the PDB-style file with coordinates for d1m57b1.
(The format of our PDB-style files is described here.)

Timeline for d1m57b1: