Lineage for d1m56j_ (1m56 J:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268140Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
  5. 268141Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein)
  6. 268142Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
    interacts with subinit I and III, function unknown, non-essential for the enzimatic activity
  7. 268145Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)
  8. 268147Domain d1m56j_: 1m56 J: [74480]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_
    complexed with ca, cu, hea, mg, peh

Details for d1m56j_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

SCOP Domain Sequences for d1m56j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56j_ f.23.8.1 (J:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

SCOP Domain Coordinates for d1m56j_:

Click to download the PDB-style file with coordinates for d1m56j_.
(The format of our PDB-style files is described here.)

Timeline for d1m56j_: