Lineage for d1m56j_ (1m56 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025589Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
    automatically mapped to Pfam PF07835
  5. 3025590Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (2 proteins)
  6. 3025591Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
    interacts with subunit I and III, function unknown, non-essential for the enzymatic activity
  7. 3025594Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)
  8. 3025596Domain d1m56j_: 1m56 J: [74480]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_
    complexed with 3pe, ca, cu, hea, mg

Details for d1m56j_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (J:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56j_ f.23.8.1 (J:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

SCOPe Domain Coordinates for d1m56j_:

Click to download the PDB-style file with coordinates for d1m56j_.
(The format of our PDB-style files is described here.)

Timeline for d1m56j_: