SCOPe 2.08: Domain d1m56j_: 1m56 J:

Lineage for d1m56j_ (1m56 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family)
   automatically mapped to Pfam PF07835

5. Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (2 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
   interacts with subunit I and III, function unknown, non-essential for the enzymatic activity

7. Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)

8. Domain d1m56j_: 1m56 J: [74480]
   Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_
   complexed with 3pe, ca, cu, hea, mg

Details for d1m56j_

PDB Entry: 1m56, 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

PDB Compounds: (J:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56j_:

Sequence; same for both SEQRES and ATOM records:

>d1m56j_ f.23.8.1 (J:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

Timeline for d1m56j_:

• d1m56j_ first appeared in SCOP 1.61, called d1m56j1
  
• d1m56j_ appears in SCOPe 2.07