Lineage for d1m56i_ (1m56 I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255238Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2255239Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2255240Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2255241Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)
  7. 2255244Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries)
  8. 2255246Domain d1m56i_: 1m56 I: [74479]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56d_, d1m56g_, d1m56h1, d1m56h2, d1m56j_
    complexed with ca, cu, hea, mg, peh

Details for d1m56i_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (I:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56i_ f.25.1.1 (I:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]}
ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
aaiwywhfvdvvwlflfasiyiwgq

SCOPe Domain Coordinates for d1m56i_:

Click to download the PDB-style file with coordinates for d1m56i_.
(The format of our PDB-style files is described here.)

Timeline for d1m56i_: