SCOPe 2.08: Domain d1m56h2: 1m56 H:30-129

Lineage for d1m56h2 (1m56 H:30-129)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries)

8. Domain d1m56h2: 1m56 H:30-129 [74478]
   Other proteins in same PDB: d1m56a_, d1m56b1, d1m56c_, d1m56d_, d1m56g_, d1m56h1, d1m56i_, d1m56j_
   complexed with 3pe, ca, cu, hea, mg

Details for d1m56h2

PDB Entry: 1m56, 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

PDB Compounds: (H:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56h2:

Sequence; same for both SEQRES and ATOM records:

>d1m56h2 f.17.2.1 (H:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d1m56h2:

• d1m56h2 first appeared in SCOP 1.61
  
• d1m56h2 appears in SCOPe 2.07