Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries) |
Domain d1m56h1: 1m56 H:130-289 [74477] Other proteins in same PDB: d1m56a_, d1m56b2, d1m56c_, d1m56d_, d1m56g_, d1m56h2, d1m56i_, d1m56j_ complexed with ca, cu, hea, mg, peh |
PDB Entry: 1m56 (more details), 2.3 Å
SCOPe Domain Sequences for d1m56h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m56h1 b.6.1.2 (H:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleqarggtyel
Timeline for d1m56h1: