| Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
| Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) ![]() |
| Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein) |
| Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species) interacts with subinit I and III, function unknown, non-essential for the enzimatic activity |
| Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries) |
| Domain d1m56d_: 1m56 D: [74475] Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_ |
PDB Entry: 1m56 (more details), 2.3 Å
SCOP Domain Sequences for d1m56d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana
Timeline for d1m56d_: