Lineage for d1m56d_ (1m56 D:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340828Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
  5. 340829Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein)
  6. 340830Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
    interacts with subinit I and III, function unknown, non-essential for the enzimatic activity
  7. 340833Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)
  8. 340834Domain d1m56d_: 1m56 D: [74475]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_

Details for d1m56d_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

SCOP Domain Sequences for d1m56d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

SCOP Domain Coordinates for d1m56d_:

Click to download the PDB-style file with coordinates for d1m56d_.
(The format of our PDB-style files is described here.)

Timeline for d1m56d_: