Lineage for d1m56c_ (1m56 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027154Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)
  7. 3027157Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries)
  8. 3027158Domain d1m56c_: 1m56 C: [74474]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56d_, d1m56g_, d1m56h1, d1m56h2, d1m56j_
    complexed with 3pe, ca, cu, hea, mg

Details for d1m56c_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (C:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]}
ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
aaiwywhfvdvvwlflfasiyiwgq

SCOPe Domain Coordinates for d1m56c_:

Click to download the PDB-style file with coordinates for d1m56c_.
(The format of our PDB-style files is described here.)

Timeline for d1m56c_: