SCOPe 2.08: Domain d1m4va2: 1m4v A:101-204

Lineage for d1m4va2 (1m4v A:101-204)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Superantigen-like protein SET3 [75370] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [75371] (3 PDB entries)

8. Domain d1m4va2: 1m4v A:101-204 [74460]
   Other proteins in same PDB: d1m4va1, d1m4vb1

Details for d1m4va2

PDB Entry: 1m4v, 1.9 Å

PDB Description: Crystal structure of SET3, a superantigen-like protein from Staphylococcus aureus

PDB Compounds: (A:) SET3, superantigen-like protein

SCOPe Domain Sequences for d1m4va2:

Sequence; same for both SEQRES and ATOM records:

>d1m4va2 d.15.6.1 (A:101-204) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk
dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir

Timeline for d1m4va2:

• d1m4va2 first appeared in SCOP 1.61
  
• d1m4va2 appears in SCOPe 2.07