Lineage for d1m4ha_ (1m4h A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 956278Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 956335Protein beta-secretase (memapsin) [50671] (1 species)
  7. 956336Species Human (Homo sapiens) [TaxId:9606] [50672] (117 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 956435Domain d1m4ha_: 1m4h A: [74455]

Details for d1m4ha_

PDB Entry: 1m4h (more details), 2.1 Å

PDB Description: crystal structure of beta-secretase complexed with inhibitor om00-3
PDB Compounds: (A:) Beta-secretase

SCOPe Domain Sequences for d1m4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ha_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
rrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
qlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsn
wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsm
iiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnl
rlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnq
sfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigf
avsachvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d1m4ha_:

Click to download the PDB-style file with coordinates for d1m4ha_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m4hb_