Lineage for d1m4gb_ (1m4g B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416835Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 416836Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 416837Family d.108.1.1: N-acetyl transferase, NAT [55730] (18 proteins)
  6. 416838Protein Aminoglycoside 2'-N-acetyltransferase [75506] (1 species)
  7. 416839Species Mycobacterium tuberculosis [TaxId:1773] [75507] (4 PDB entries)
  8. 416845Domain d1m4gb_: 1m4g B: [74454]
    complexed with coa, pap, rio

Details for d1m4gb_

PDB Entry: 1m4g (more details), 1.8 Å

PDB Description: Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis-Complex with Coenzyme A and Ribostamycin

SCOP Domain Sequences for d1m4gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4gb_ d.108.1.1 (B:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis}
htarlvhtadldsetrqdirqmvtgafagdftetdwehtlggmhaliwhhgaiiahaavi
qrrliyrgnalrcgyvegvavradwrgqrlvsalldaveqvmrgayqlgalsssararrl
yasrgwlpwhgptsvlaptgpvrtpdddgtvfvlpidisldtsaelmcdwragdvw

SCOP Domain Coordinates for d1m4gb_:

Click to download the PDB-style file with coordinates for d1m4gb_.
(The format of our PDB-style files is described here.)

Timeline for d1m4gb_: