Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Interleukin-2 (IL-2) [47301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47302] (20 PDB entries) |
Domain d1m4cb_: 1m4c B: [74450] |
PDB Entry: 1m4c (more details), 2.4 Å
SCOPe Domain Sequences for d1m4cb_:
Sequence, based on SEQRES records: (download)
>d1m4cb_ a.26.1.2 (B:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfc qsiistl
>d1m4cb_ a.26.1.2 (B:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlardlisninvivlelkgsfmceyadetativeflnrwitfcqsiistl
Timeline for d1m4cb_: