SCOPe 2.07: Domain d1m43b_: 1m43 B:

Lineage for d1m43b_ (1m43 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)

8. Domain d1m43b_: 1m43 B: [74439]

Details for d1m43b_

PDB Entry: 1m43, 2.4 Å

PDB Description: crystal structure of pmii in complex with pepstatin a to 2.4 a

PDB Compounds: (B:) plasmepsin II

SCOPe Domain Sequences for d1m43b_:

Sequence; same for both SEQRES and ATOM records:

>d1m43b_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
filgdpfmrkyftvfdydnhsvgialakknl

Timeline for d1m43b_:

• d1m43b_ first appeared in SCOP 1.61
  
• d1m43b_ appears in SCOPe 2.06
  
• d1m43b_ appears in the current release, SCOPe 2.08