Lineage for d1m43a_ (1m43 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231766Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 231913Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 231914Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (7 PDB entries)
  8. 231922Domain d1m43a_: 1m43 A: [74438]

Details for d1m43a_

PDB Entry: 1m43 (more details), 2.4 Å

PDB Description: crystal structure of pmii in complex with pepstatin a to 2.4 a

SCOP Domain Sequences for d1m43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m43a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II}
lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
filgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1m43a_:

Click to download the PDB-style file with coordinates for d1m43a_.
(The format of our PDB-style files is described here.)

Timeline for d1m43a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m43b_