SCOP 1.63: Domain d1m3xm_: 1m3x M:

Lineage for d1m3xm_ (1m3x M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)

8. Domain d1m3xm_: 1m3x M: [74436]
   Other proteins in same PDB: d1m3xh1, d1m3xh2, d1m3xl_
   complexed with bcl, bph, cdl, cl, fe, ggd, pc2, spo, u10

Details for d1m3xm_

PDB Entry: 1m3x, 2.55 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1m3xm_:

Sequence; same for both SEQRES and ATOM records:

>d1m3xm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1m3xm_:

• d1m3xm_ first appeared in SCOP 1.61, called d1m3xm1
  
• d1m3xm_ appears in SCOP 1.65
  
• d1m3xm_ appears in the current release, SCOPe 2.08