Lineage for d1m3xh1 (1m3x H:36-248)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229641Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 229642Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 229643Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 229644Protein Photosynthetic reaction centre [50348] (3 species)
  7. 229645Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)
  8. 229649Domain d1m3xh1: 1m3x H:36-248 [74433]
    Other proteins in same PDB: d1m3xh2, d1m3xl_, d1m3xm_
    complexed with bcl, bph, cdl, cl, fe, ggd, pc2, spo, u10

Details for d1m3xh1

PDB Entry: 1m3x (more details), 2.55 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1m3xh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3xh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

SCOP Domain Coordinates for d1m3xh1:

Click to download the PDB-style file with coordinates for d1m3xh1.
(The format of our PDB-style files is described here.)

Timeline for d1m3xh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m3xh2