| Class b: All beta proteins [48724] (119 folds) |
| Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) ![]() |
| Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
| Protein Photosynthetic reaction centre [50348] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries) |
| Domain d1m3xh1: 1m3x H:36-248 [74433] Other proteins in same PDB: d1m3xh2, d1m3xl_, d1m3xm_ complexed with bcl, bph, cdl, cl, fe, ggd, pc2, spo, u10 |
PDB Entry: 1m3x (more details), 2.55 Å
SCOP Domain Sequences for d1m3xh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3xh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr
Timeline for d1m3xh1: