Lineage for d1m1xb4 (1m1x B:532-562)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636564Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 2636565Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 2636566Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
    Uniprot P05106 27-716
  8. 2636567Domain d1m1xb4: 1m1x B:532-562 [74429]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3
    complexed with mn, nag

Details for d1m1xb4

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1m1xb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
kgemcsghgqcscgdclcdsdwtgyycnctt

SCOPe Domain Coordinates for d1m1xb4:

Click to download the PDB-style file with coordinates for d1m1xb4.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb4: