SCOPe 2.06: Domain d1m1xb3: 1m1x B:606-690

Lineage for d1m1xb3 (1m1x B:606-690)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
   alpha-beta-loop-beta(3); loop across free side of beta-sheet

4. Superfamily d.200.1: Integrin beta tail domain [69687] (1 family)
   automatically mapped to Pfam PF07965

5. Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)

6. Protein Integrin beta tail domain [69689] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries)
   Uniprot P05106 27-716

8. Domain d1m1xb3: 1m1x B:606-690 [74428]
   Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb4, d1m1xb5
   complexed with mn, nag

Details for d1m1xb3

PDB Entry: 1m1x, 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1m1xb3:

Sequence; same for both SEQRES and ATOM records:

>d1m1xb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

Timeline for d1m1xb3:

• d1m1xb3 first appeared in SCOP 1.61
  
• d1m1xb3 appears in SCOPe 2.05
  
• d1m1xb3 appears in SCOPe 2.07
  
• d1m1xb3 appears in the current release, SCOPe 2.08