![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.200: Integrin beta tail domain [69686] (1 superfamily) alpha-beta-loop-beta(3); loop across free side of beta-sheet |
![]() | Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) ![]() automatically mapped to Pfam PF07965 |
![]() | Family d.200.1.1: Integrin beta tail domain [69688] (1 protein) |
![]() | Protein Integrin beta tail domain [69689] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries) Uniprot P05106 27-716 |
![]() | Domain d1m1xb3: 1m1x B:606-690 [74428] Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb4, d1m1xb5 complexed with mn, nag |
PDB Entry: 1m1x (more details), 3.3 Å
SCOPe Domain Sequences for d1m1xb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1xb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]} dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv rfqyyedssgksilyvveepecpkg
Timeline for d1m1xb3:
![]() Domains from same chain: (mouse over for more information) d1m1xb1, d1m1xb2, d1m1xb4, d1m1xb5 |
![]() Domains from other chains: (mouse over for more information) d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4 |