Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (5 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
Protein Integrin beta A domain [69542] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69543] (10 PDB entries) |
Domain d1m1xb2: 1m1x B:107-354 [74427] Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb3, d1m1xb4, d1m1xb5 complexed with mn, nag |
PDB Entry: 1m1x (more details), 3.3 Å
SCOP Domain Sequences for d1m1xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1xb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd aygkirsk
Timeline for d1m1xb2:
View in 3D Domains from same chain: (mouse over for more information) d1m1xb1, d1m1xb3, d1m1xb4, d1m1xb5 |
View in 3D Domains from other chains: (mouse over for more information) d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4 |