SCOP 1.73: Domain d1m1xb2: 1m1x B:107-354

Lineage for d1m1xb2 (1m1x B:107-354)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein Integrin beta A domain [69542] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69543] (10 PDB entries)

8. Domain d1m1xb2: 1m1x B:107-354 [74427]
   Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb3, d1m1xb4, d1m1xb5
   complexed with mn, nag

Details for d1m1xb2

PDB Entry: 1m1x, 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1m1xb2:

Sequence; same for both SEQRES and ATOM records:

>d1m1xb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

Timeline for d1m1xb2:

• d1m1xb2 first appeared in SCOP 1.61
  
• d1m1xb2 appears in SCOP 1.71
  
• d1m1xb2 appears in SCOP 1.75
  
• d1m1xb2 appears in the current release, SCOPe 2.08