SCOPe 2.07: Domain d1m1xb1: 1m1x B:55-106,B:355-434

Lineage for d1m1xb1 (1m1x B:55-106,B:355-434)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.1: Integrin domains [69180] (2 proteins)

6. Protein Hybrid domain of integrin beta [69183] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
   Uniprot P05106 27-466

8. Domain d1m1xb1: 1m1x B:55-106,B:355-434 [74426]
   Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5
   complexed with mn, nag

Details for d1m1xb1

PDB Entry: 1m1x, 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1m1xb1:

Sequence; same for both SEQRES and ATOM records:

>d1m1xb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

Timeline for d1m1xb1:

• d1m1xb1 first appeared in SCOP 1.61
  
• d1m1xb1 appears in SCOPe 2.06
  
• d1m1xb1 appears in the current release, SCOPe 2.08