Lineage for d1m1ra_ (1m1r A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347351Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2347385Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 2347410Species Shewanella oneidensis [TaxId:70863] [74808] (4 PDB entries)
  8. 2347412Domain d1m1ra_: 1m1r A: [74420]
    complexed with hem, so4

Details for d1m1ra_

PDB Entry: 1m1r (more details), 1.02 Å

PDB Description: reduced p222 crystal structure of the tetraheme cytochrome c of shewanella oneidensis mr1
PDB Compounds: (A:) small tetraheme cytochrome c

SCOPe Domain Sequences for d1m1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ra_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]}
adqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcad
chavhdmnvgqkptceschddgrtsasvlkk

SCOPe Domain Coordinates for d1m1ra_:

Click to download the PDB-style file with coordinates for d1m1ra_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ra_: