Lineage for d1m1ra_ (1m1r A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins) Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) Species Shewanella oneidensis [TaxId:70863] [74808] (3 PDB entries) 
Domain d1m1ra_: 1m1r A: [74420]
Details for d1m1ra_
PDB Entry: 1m1r (more details), 1.02 Å
PDB Description: reduced p222 crystal structure of the tetraheme cytochrome c of shewanella oneidensis mr1
SCOP Domain Sequences for d1m1ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1ra_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis}
adqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcad
chavhdmnvgqkptceschddgrtsasvlkk
SCOP Domain Coordinates for d1m1ra_:
Click to download the PDB-style file with coordinates for d1m1ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m1ra_:
- d1m1ra_ is new in SCOP 1.61
- d1m1ra_ appears in SCOP 1.63
- d1m1ra_ appears in the current release, SCOPe 2.08
View in 3D