Class a: All alpha proteins [46456] (286 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
Species Shewanella oneidensis [TaxId:70863] [74808] (3 PDB entries) |
Domain d1m1pe_: 1m1p E: [74417] complexed with hem, so4 |
PDB Entry: 1m1p (more details), 1.55 Å
SCOPe Domain Sequences for d1m1pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1pe_ a.138.1.3 (E:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} dqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadc havhdmnvgqkptceschddgrtsasvl
Timeline for d1m1pe_: