SCOPe 2.04: Domain d1m1mb1: 1m1m B:5-185

Lineage for d1m1mb1 (1m1m B:5-185)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)

8. Domain d1m1mb1: 1m1m B:5-185 [74411]

Details for d1m1mb1

PDB Entry: 1m1m, 2.7 Å

PDB Description: x-ray crystal structure of mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii (mtfabh)

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase III

SCOPe Domain Sequences for d1m1mb1:

Sequence; same for both SEQRES and ATOM records:

>d1m1mb1 c.95.1.2 (B:5-185) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
iattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddesaas
mateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagca
gfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqg
i

Timeline for d1m1mb1:

• d1m1mb1 first appeared in SCOP 1.61
  
• d1m1mb1 appears in SCOPe 2.03
  
• d1m1mb1 appears in SCOPe 2.05
  
• d1m1mb1 appears in the current release, SCOPe 2.08