Lineage for d1m1ma1 (1m1m A:2-185)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186537Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 186538Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 186539Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 186633Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 186651Species Mycobacterium tuberculosis [TaxId:1773] [64196] (2 PDB entries)
  8. 186656Domain d1m1ma1: 1m1m A:2-185 [74409]

Details for d1m1ma1

PDB Entry: 1m1m (more details), 2.7 Å

PDB Description: x-ray crystal structure of mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii (mtfabh)

SCOP Domain Sequences for d1m1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ma1 c.95.1.1 (A:2-185) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

SCOP Domain Coordinates for d1m1ma1:

Click to download the PDB-style file with coordinates for d1m1ma1.
(The format of our PDB-style files is described here.)

Timeline for d1m1ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m1ma2