Lineage for d1m1ky_ (1m1k Y:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255932Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 255933Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 255934Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 255935Protein Ribosomal protein L31e [54577] (1 species)
  7. 255936Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (8 PDB entries)
  8. 255944Domain d1m1ky_: 1m1k Y: [74407]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1ky_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1ky_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ky_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1m1ky_:

Click to download the PDB-style file with coordinates for d1m1ky_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ky_: