Lineage for d1m1kq_ (1m1k Q:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919879Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 919880Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 919881Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 919882Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 919883Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 919937Domain d1m1kq_: 1m1k Q: [74399]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1kq_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (Q:) ribosomal protein l19e

SCOPe Domain Sequences for d1m1kq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kq_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1m1kq_:

Click to download the PDB-style file with coordinates for d1m1kq_.
(The format of our PDB-style files is described here.)

Timeline for d1m1kq_: