Lineage for d1m1kp_ (1m1k P:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690462Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 690463Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 690464Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 690517Protein Ribosomal protein L18e [52084] (1 species)
  7. 690518Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
  8. 690541Domain d1m1kp_: 1m1k P: [74398]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1kp_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (P:) ribosomal protein l18e

SCOP Domain Sequences for d1m1kp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kp_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1m1kp_:

Click to download the PDB-style file with coordinates for d1m1kp_.
(The format of our PDB-style files is described here.)

Timeline for d1m1kp_: