Lineage for d1m1kl_ (1m1k L:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558970Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 558971Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 558972Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 558973Protein Ribosomal protein L14 [50195] (2 species)
  7. 558974Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (19 PDB entries)
  8. 558992Domain d1m1kl_: 1m1k L: [74394]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1kl_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1kl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kl_ b.39.1.1 (L:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1m1kl_:

Click to download the PDB-style file with coordinates for d1m1kl_.
(The format of our PDB-style files is described here.)

Timeline for d1m1kl_: