Lineage for d1m1ki_ (1m1k I:)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2272904Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 2272905Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 2272906Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 2272907Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 2272908Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 2272947Domain d1m1ki_: 1m1k I: [74391]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1ki_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1m1ki_:

Sequence, based on SEQRES records: (download)

>d1m1ki_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1m1ki_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1m1ki_:

Click to download the PDB-style file with coordinates for d1m1ki_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ki_: