Lineage for d1m1kg1 (1m1k G:1-79)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334675Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 334676Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 334677Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 334678Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 334679Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (12 PDB entries)
  8. 334702Domain d1m1kg1: 1m1k G:1-79 [74388]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_

Details for d1m1kg1

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1kg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kg1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1m1kg1:

Click to download the PDB-style file with coordinates for d1m1kg1.
(The format of our PDB-style files is described here.)

Timeline for d1m1kg1: