Lineage for d1m1kf_ (1m1k F:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193580Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
  4. 193581Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 193582Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 193583Protein Ribosomal protein L5 [55284] (2 species)
  7. 193584Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (7 PDB entries)
  8. 193591Domain d1m1kf_: 1m1k F: [74387]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_

Details for d1m1kf_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (F:)

SCOP Domain Sequences for d1m1kf_:

Sequence, based on SEQRES records: (download)

>d1m1kf_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1m1kf_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1m1kf_:

Click to download the PDB-style file with coordinates for d1m1kf_.
(The format of our PDB-style files is described here.)

Timeline for d1m1kf_: