Lineage for d1m1kc2 (1m1k C:1-90)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399426Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2399464Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    Uniprot P20276
    includes the N-terminal tail
  8. 2399495Domain d1m1kc2: 1m1k C:1-90 [74384]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1kc2

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (C:) ribosomal protein l2

SCOPe Domain Sequences for d1m1kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kc2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOPe Domain Coordinates for d1m1kc2:

Click to download the PDB-style file with coordinates for d1m1kc2.
(The format of our PDB-style files is described here.)

Timeline for d1m1kc2: