SCOPe 2.07: Domain d1m1k4_: 1m1k 4:

Lineage for d1m1k4_ (1m1k 4:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1m1k4_: 1m1k 4: [74382]
   Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
   complexed with cd, cl, k, mg, na, zit

Details for d1m1k4_

PDB Entry: 1m1k, 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (4:) ribosomal protein l44e

SCOPe Domain Sequences for d1m1k4_:

Sequence; same for both SEQRES and ATOM records:

>d1m1k4_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1m1k4_:

• d1m1k4_ first appeared in SCOP 1.61
  
• d1m1k4_ appears in SCOPe 2.06
  
• d1m1k4_ appears in the current release, SCOPe 2.08