Lineage for d1m1k3_ (1m1k 3:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156940Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
  4. 156941Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
  5. 156942Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 156943Protein Ribosomal protein L39e [48664] (1 species)
  7. 156944Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (7 PDB entries)
  8. 156951Domain d1m1k3_: 1m1k 3: [74381]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_

Details for d1m1k3_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1k3_:

Sequence, based on SEQRES records: (download)

>d1m1k3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1m1k3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1m1k3_:

Click to download the PDB-style file with coordinates for d1m1k3_.
(The format of our PDB-style files is described here.)

Timeline for d1m1k3_: