Lineage for d1m1k1_ (1m1k 1:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245345Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 1245346Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1245347Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1245401Domain d1m1k1_: 1m1k 1: [74379]
    Other proteins in same PDB: d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1k1_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (1:) ribosomal protein l37ae

SCOPe Domain Sequences for d1m1k1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1k1_ g.41.8.1 (1:) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOPe Domain Coordinates for d1m1k1_:

Click to download the PDB-style file with coordinates for d1m1k1_.
(The format of our PDB-style files is described here.)

Timeline for d1m1k1_: