Lineage for d1m1k1_ (1m1k 1:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344467Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 344468Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 344469Protein Ribosomal protein L37ae [57831] (1 species)
  7. 344470Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (12 PDB entries)
  8. 344482Domain d1m1k1_: 1m1k 1: [74379]
    Other proteins in same PDB: d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1k1_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1k1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1k1_ g.41.8.1 (1:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1m1k1_:

Click to download the PDB-style file with coordinates for d1m1k1_.
(The format of our PDB-style files is described here.)

Timeline for d1m1k1_: