![]() | Class h: Coiled coil proteins [57942] (5 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein) |
![]() | Protein Fibrinogen coiled-coil and central regions [58012] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [69976] (1 PDB entry) |
![]() | Domain d1m1jc2: 1m1j C:4-141 [74373] Other proteins in same PDB: d1m1jb1, d1m1jc1, d1m1je1, d1m1jf1 |
PDB Entry: 1m1j (more details), 2.7 Å
SCOP Domain Sequences for d1m1jc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1jc2 h.1.8.1 (C:4-141) Fibrinogen coiled-coil and central regions {Chicken (Gallus gallus)} trenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqh iktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitq lkqkiaqleshcqepckd
Timeline for d1m1jc2: